PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi3g42430.1.p
Common NameBRADI_3g42430, LOC100842162
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 269aa    MW: 29637.1 Da    PI: 5.9153
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi3g42430.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.42.5e-161461148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      rg+WT+eEd +lv  +  +G  +W+++++  g+ R++k+c++rw +yl
  Bradi3g42430.1.p 14 RGPWTAEEDNKLVSFILTHGRCCWRAVPKLAGLLRCGKSCRLRWTNYL 61
                      89******************************99************97 PP

2Myb_DNA-binding56.28.1e-1869111347
                       SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         T++E++l vd++++lG++ W++Ia++++ gRt++++k++w+++
  Bradi3g42430.1.p  69 LLTADEEKLVVDLHAKLGNR-WSKIAAKLP-GRTDNEIKNHWNTH 111
                       569*****************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.6E-21563IPR009057Homeodomain-like
PROSITE profilePS5129414.555961IPR017930Myb domain
SuperFamilySSF466893.03E-2711108IPR009057Homeodomain-like
SMARTSM007178.6E-131363IPR001005SANT/Myb domain
PfamPF002498.1E-151461IPR001005SANT/Myb domain
CDDcd001671.88E-101661No hitNo description
PROSITE profilePS5129427.42962116IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.8E-2564117IPR009057Homeodomain-like
SMARTSM007171.5E-1566114IPR001005SANT/Myb domain
PfamPF002491.8E-1569111IPR001005SANT/Myb domain
CDDcd001675.44E-1371112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 269 aa     Download sequence    Send to blast
MGRQPCCDKQ GVKRGPWTAE EDNKLVSFIL THGRCCWRAV PKLAGLLRCG KSCRLRWTNY  60
LRPDLKRGLL TADEEKLVVD LHAKLGNRWS KIAAKLPGRT DNEIKNHWNT HIKKKLIKMG  120
IDPATHQPLA NTKAASPIGT TSQSTSFKSS DTVNQLDSKG THGEGVSRPT DSSEHSSRNT  180
SDDDQDLLAN LLLEEELPVD EPWLNFESSN DDEFSSIIGQ LLCDGPTDWL LDYQDVGMGG  240
SSLIDQDFGS PSSNLTEGAV RSSEESKF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-28141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003574901.10.0PREDICTED: protein ODORANT1-like
SwissprotQ50EX61e-85ODO1_PETHY; Protein ODORANT1
TrEMBLI1I9B30.0I1I9B3_BRADI; Uncharacterized protein
STRINGBRADI3G42430.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP7938563
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G22680.16e-83myb domain protein 85